PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK21494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family SRS
Protein Properties Length: 375aa    MW: 40707.9 Da    PI: 7.3511
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK21494.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702217.33.5e-671502963154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                sg++sCqdCGnqakkdC+h+RCRtCCksrg+dC+thvkstWvpa+krrerqq+++++ss +     ++++kr r++++++   +s+++  +++++  le+
  PK21494.1 150 SGGVSCQDCGNQAKKDCVHMRCRTCCKSRGYDCQTHVKSTWVPASKRRERQQHQQQLSSLQ-----QQQPKRLRDSNNNALIISSNSSRLQTTHSGGLEV 244
                7899***********************************************9999886555.....4455555555444443333333344445568999 PP

     DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 ++P+ev+s+avfrcv+vss++d+++++aYqtav+igGhvfkGiLyd+Gle+
  PK21494.1 245 GNFPSEVNSQAVFRCVKVSSMEDNDDQYAYQTAVNIGGHVFKGILYDHGLET 296
                9************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-63152295IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.3E-28154196IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.1E-27247294IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
XNNNNNNSNN NNIQAHPETF FWYNVKPHNN NNDHQTNNNN TSTTFELWQQ EQQAALLHLQ  60
TIPTRPHHHH HSHHHHQDLY SSAAALGVGP SSYRSLGAGA AAGGGGSITV DSSDEQHHES  120
TSAARFMMMR SSNSSGGVGG GSGGLLGSSS GGVSCQDCGN QAKKDCVHMR CRTCCKSRGY  180
DCQTHVKSTW VPASKRRERQ QHQQQLSSLQ QQQPKRLRDS NNNALIISSN SSRLQTTHSG  240
GLEVGNFPSE VNSQAVFRCV KVSSMEDNDD QYAYQTAVNI GGHVFKGILY DHGLETNYNN  300
MVGETSSGGG GGNNQSVQPL DLITVAATAT TAEASPSVGA FDPSSLYQQQ QQQQQQQQPL  360
NTYIAGTQFF LPPRS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113475.13e-97hypothetical protein L484_026809
TrEMBLW9SNC64e-97W9SNC6_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.13e-60Lateral root primordium (LRP) protein-related